SCOPe 2.07: Domain d6ru3c1: 6ru3 C:2-123

Lineage for d6ru3c1 (6ru3 C:2-123)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d6ru3c1: 6ru3 C:2-123 [373310]
   Other proteins in same PDB: d6ru3c2
   automated match to d4u7sa_

Details for d6ru3c1

PDB Entry: 6ru3, 1.26 Å

PDB Description: crystal structure of the fp specific nanobody hfpnb1

PDB Compounds: (C:) hFP1Nb1

SCOPe Domain Sequences for d6ru3c1:

Sequence; same for both SEQRES and ATOM records:

>d6ru3c1 b.1.1.1 (C:2-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasertftiyamgwfrqapgkerefvaaisrsgentdy
adsvkgrftisrdnnkntislqmnslkpedtavyycaagrailvhttkkeydhwgqgtqv
tv

Timeline for d6ru3c1:

• d6ru3c1 is new in SCOPe 2.07-stable
  
• d6ru3c1 appears in the current release, SCOPe 2.08