Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein automated matches [190085] (58 species) not a true protein |
Species Acinetobacter baumannii [TaxId:575584] [373078] (2 PDB entries) |
Domain d6aheb_: 6ahe B: [373136] automated match to d4zjua_ complexed with 0we, nad |
PDB Entry: 6ahe (more details), 2.29 Å
SCOPe Domain Sequences for d6aheb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aheb_ c.2.1.2 (B:) automated matches {Acinetobacter baumannii [TaxId: 575584]} qgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsklv fpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahdis aysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylasslgv dgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwasg itgeilyvdagfntvgmsqs
Timeline for d6aheb_: