Lineage for d6aheb_ (6ahe B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2451247Protein automated matches [190085] (58 species)
    not a true protein
  7. 2451260Species Acinetobacter baumannii [TaxId:575584] [373078] (2 PDB entries)
  8. 2451263Domain d6aheb_: 6ahe B: [373136]
    automated match to d4zjua_
    complexed with 0we, nad

Details for d6aheb_

PDB Entry: 6ahe (more details), 2.29 Å

PDB Description: crystal structure of enoyl-acp reductase from acinetobacter baumannii in complex with nad and afn-1252
PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d6aheb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aheb_ c.2.1.2 (B:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
qgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsklv
fpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahdis
aysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylasslgv
dgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwasg
itgeilyvdagfntvgmsqs

SCOPe Domain Coordinates for d6aheb_:

Click to download the PDB-style file with coordinates for d6aheb_.
(The format of our PDB-style files is described here.)

Timeline for d6aheb_: