SCOPe 2.07: Domain d6edha_: 6edh A:

Lineage for d6edha_ (6edh A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins)
   automatically mapped to Pfam PF02668

6. Protein Taurine/alpha-ketoglutarate dioxygenase TauD [75039] (2 species)

7. Species Escherichia coli [TaxId:83333] [373113] (1 PDB entry)

8. Domain d6edha_: 6edh A: [373130]
   automated match to d1otja_
   complexed with 1pe, act, peg, pg4, sin, tau, vvo

Details for d6edha_

PDB Entry: 6edh, 1.73 Å

PDB Description: taurine:2og dioxygenase (taud) bound to the vanadyl ion, taurine, and succinate

PDB Compounds: (A:) Alpha-Ketoglutarate-Dependent Taurine Dioxygenase

SCOPe Domain Sequences for d6edha_:

Sequence; same for both SEQRES and ATOM records:

>d6edha_ b.82.2.5 (A:) Taurine/alpha-ketoglutarate dioxygenase TauD {Escherichia coli [TaxId: 83333]}
erlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaq
rfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpst
ggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknp
pllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqp
ndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyrag

Timeline for d6edha_:

• d6edha_ is new in SCOPe 2.07-stable
  
• d6edha_ appears in the current release, SCOPe 2.08