Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
Superfamily d.100.2: MbtH-like [160582] (2 families) the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position |
Family d.100.2.0: automated matches [254253] (1 protein) not a true family |
Protein automated matches [254578] (8 species) not a true protein |
Species Thermobifida fusca [TaxId:269800] [372555] (2 PDB entries) |
Domain d6ebya_: 6eby A: [373084] automated match to d2gpfa1 |
PDB Entry: 6eby (more details), 1.85 Å
SCOPe Domain Sequences for d6ebya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ebya_ d.100.2.0 (A:) automated matches {Thermobifida fusca [TaxId: 269800]} npfdddegvflvlvndedqyslwpefaevpqgwrtvfgptsraaaldyinthwt
Timeline for d6ebya_: