Lineage for d6jjjc_ (6jjj C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608590Species Mouse (Mus musculus) [TaxId:10090] [187331] (29 PDB entries)
  8. 2608645Domain d6jjjc_: 6jjj C: [372967]
    automated match to d1xpha_
    complexed with ca

Details for d6jjjc_

PDB Entry: 6jjj (more details), 2.79 Å

PDB Description: trimeric structure of kupffer cell c-type lectin receptor clec4f
PDB Compounds: (C:) C-type lectin domain family 4 member F

SCOPe Domain Sequences for d6jjjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jjjc_ d.169.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahlasvts
qeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrhrnge
redcvhvrqqwndmacgssypwvckkstgws

SCOPe Domain Coordinates for d6jjjc_:

Click to download the PDB-style file with coordinates for d6jjjc_.
(The format of our PDB-style files is described here.)

Timeline for d6jjjc_: