Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (20 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187331] (29 PDB entries) |
Domain d6jjjc_: 6jjj C: [372967] automated match to d1xpha_ complexed with ca |
PDB Entry: 6jjj (more details), 2.79 Å
SCOPe Domain Sequences for d6jjjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jjjc_ d.169.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} eavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahlasvts qeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrhrnge redcvhvrqqwndmacgssypwvckkstgws
Timeline for d6jjjc_: