Lineage for d6i5fa3 (6i5f A:270-566)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725135Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 2725136Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) (S)
  5. 2725164Family a.113.1.0: automated matches [254202] (1 protein)
    not a true family
  6. 2725165Protein automated matches [254442] (1 species)
    not a true protein
  7. 2725166Species Escherichia coli [TaxId:562] [254939] (3 PDB entries)
  8. 2725171Domain d6i5fa3: 6i5f A:270-566 [372928]
    Other proteins in same PDB: d6i5fa1, d6i5fa2, d6i5fa4, d6i5fb1, d6i5fb2, d6i5fb4
    automated match to d1wb9a1
    complexed with adp, gol, so4; mutant

Details for d6i5fa3

PDB Entry: 6i5f (more details), 2.6 Å

PDB Description: crystal structure of dna-free e.coli muts p839e dimer mutant
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d6i5fa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i5fa3 a.113.1.0 (A:270-566) automated matches {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOPe Domain Coordinates for d6i5fa3:

Click to download the PDB-style file with coordinates for d6i5fa3.
(The format of our PDB-style files is described here.)

Timeline for d6i5fa3: