| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily) multihelical; consists of 2 all-alpha subdomains |
Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) ![]() |
| Family a.113.1.0: automated matches [254202] (1 protein) not a true family |
| Protein automated matches [254442] (1 species) not a true protein |
| Species Escherichia coli [TaxId:562] [254939] (3 PDB entries) |
| Domain d6i5fa3: 6i5f A:270-566 [372928] Other proteins in same PDB: d6i5fa1, d6i5fa2, d6i5fa4, d6i5fb1, d6i5fb2, d6i5fb4 automated match to d1wb9a1 complexed with adp, gol, so4; mutant |
PDB Entry: 6i5f (more details), 2.6 Å
SCOPe Domain Sequences for d6i5fa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i5fa3 a.113.1.0 (A:270-566) automated matches {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln
Timeline for d6i5fa3:
View in 3DDomains from other chains: (mouse over for more information) d6i5fb1, d6i5fb2, d6i5fb3, d6i5fb4 |