Lineage for d6ebba_ (6ebb A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2463696Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2463813Protein DNA-binding response regulator MicA, N-terminal domain [102232] (1 species)
  7. 2463814Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [102233] (14 PDB entries)
  8. 2463827Domain d6ebba_: 6ebb A: [372846]
    automated match to d1nxoa_

Details for d6ebba_

PDB Entry: 6ebb (more details), 2.02 Å

PDB Description: crystal structure of yycf homologue, crystals grown in tris buffer
PDB Compounds: (A:) DNA-binding response regulator

SCOPe Domain Sequences for d6ebba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ebba_ c.23.1.1 (A:) DNA-binding response regulator MicA, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidgl
evaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrrs

SCOPe Domain Coordinates for d6ebba_:

Click to download the PDB-style file with coordinates for d6ebba_.
(The format of our PDB-style files is described here.)

Timeline for d6ebba_: