SCOPe 2.07: Domain d6p98b_: 6p98 B:

Lineage for d6p98b_ (6p98 B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)

8. Domain d6p98b_: 6p98 B: [372758]
   automated match to d1nrfa_
   complexed with ca, cd, cl, ke1

Details for d6p98b_

PDB Entry: 6p98, 1.75 Å

PDB Description: oxa-48 carbapanemase, meropenem complex

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6p98b_:

Sequence; same for both SEQRES and ATOM records:

>d6p98b_ e.3.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdl
gvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafd
ygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdy
iiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqeki
ip

Timeline for d6p98b_:

• d6p98b_ is new in SCOPe 2.07-stable
  
• d6p98b_ appears in the current release, SCOPe 2.08