SCOPe 2.07: Domain d6nmrk2: 6nmr K:108-213

Lineage for d6nmrk2 (6nmr K:108-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6nmrk2: 6nmr K:108-213 [372673]
   Other proteins in same PDB: d6nmrb1, d6nmre_, d6nmrg1, d6nmri_, d6nmrk1, d6nmrl1, d6nmrm_, d6nmrs_
   automated match to d1dn0a2

Details for d6nmrk2

PDB Entry: 6nmr, 2.42 Å

PDB Description: blocking fab 119 anti-sirp-alpha antibody in complex with sirp-alpha variant 1

PDB Compounds: (K:) Fab 119 anti-SIRP-alpha antibody Variable Light Chain

SCOPe Domain Sequences for d6nmrk2:

Sequence; same for both SEQRES and ATOM records:

>d6nmrk2 b.1.1.2 (K:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d6nmrk2:

• d6nmrk2 is new in SCOPe 2.07-stable
  
• d6nmrk2 appears in the current release, SCOPe 2.08