Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d6nmrk2: 6nmr K:108-213 [372673] Other proteins in same PDB: d6nmrb1, d6nmre_, d6nmrg1, d6nmri_, d6nmrk1, d6nmrl1, d6nmrm_, d6nmrs_ automated match to d1dn0a2 |
PDB Entry: 6nmr (more details), 2.42 Å
SCOPe Domain Sequences for d6nmrk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nmrk2 b.1.1.2 (K:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d6nmrk2: