Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily) consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5 Domain 2 has parallel beta-sheet of 4 strands, order 1234 |
Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) |
Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 proteins) automatically mapped to Pfam PF00710 |
Protein automated matches [190446] (9 species) not a true protein |
Species Escherichia coli [TaxId:83333] [372613] (2 PDB entries) |
Domain d6nxcb1: 6nxc B:1-337 [372623] Other proteins in same PDB: d6nxcb2, d6nxcd2 automated match to d2p2dd_ complexed with asn, cit, cl, edo, gol; mutant |
PDB Entry: 6nxc (more details), 1.74 Å
SCOPe Domain Sequences for d6nxcb1:
Sequence, based on SEQRES records: (download)
>d6nxcb1 c.88.1.1 (B:1-337) automated matches {Escherichia coli [TaxId: 83333]} mqkksiyvaytggtigmqrseqgyipvsghlqrqlalmpefhrpempdftiheytplmds sdmtpedwqhiaedikahyddydgfvilhgtdtmaytasalsfmlenlgkpvivtgsqip laelrsdgqinllnalyvaanypinevtlffnnrlyrgnrtakahadgfdafaspnlppl leagihirrlntppaphgegelivhpitpqpigvvtiypgisadvvrnflrqpvkalilr sygvgnapqnkaflqelqeasdrgivvvnltqcmsgkvnmggyatgnalahagviggadm tveatltklhyllsqeldtetirkamsqnlrgeltpd
>d6nxcb1 c.88.1.1 (B:1-337) automated matches {Escherichia coli [TaxId: 83333]} mqkksiyvaytggtigmqrsghlqrqlalmpefhrpempdftiheytplmdssdmtpedw qhiaedikahyddydgfvilhgtdtmaytasalsfmlenlgkpvivtgsqiplaelrsdg qinllnalyvaanypinevtlffnnrlyrgnrtakahadgfdafaspnlpplleagihir rlntppaphgegelivhpitpqpigvvtiypgisadvvrnflrqpvkalilrsygvgnap qnkaflqelqeasdrgivvvnltqcmsgkvnmggyatgnalahagviggadmtveatltk lhyllsqeldtetirkamsqnlrgeltpd
Timeline for d6nxcb1:
View in 3D Domains from other chains: (mouse over for more information) d6nxca_, d6nxcc_, d6nxcd1, d6nxcd2 |