Lineage for d6mkwa_ (6mkw A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521698Protein Lysine-,arginine-,ornithine-binding (LAO) protein [53856] (4 species)
  7. 2521701Species Salmonella typhimurium [TaxId:588858] [372567] (2 PDB entries)
  8. 2521704Domain d6mkwa_: 6mkw A: [372592]
    automated match to d1lsta_
    complexed with gol, his; mutant

Details for d6mkwa_

PDB Entry: 6mkw (more details), 2.32 Å

PDB Description: crystal structure of the periplasmic lysine-, arginine-, ornithine- binding protein (lao) d11a mutant from salmonella typhimurium complexed with histidine
PDB Compounds: (A:) Lysine/arginine/ornithine transport protein

SCOPe Domain Sequences for d6mkwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mkwa_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 588858]}
lpqtvrigtattyapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipslka
kkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgst
qeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyafa
gpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvygd

SCOPe Domain Coordinates for d6mkwa_:

Click to download the PDB-style file with coordinates for d6mkwa_.
(The format of our PDB-style files is described here.)

Timeline for d6mkwa_: