Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein Lysine-,arginine-,ornithine-binding (LAO) protein [53856] (4 species) |
Species Salmonella typhimurium [TaxId:588858] [372567] (2 PDB entries) |
Domain d6mkwa_: 6mkw A: [372592] automated match to d1lsta_ complexed with gol, his; mutant |
PDB Entry: 6mkw (more details), 2.32 Å
SCOPe Domain Sequences for d6mkwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mkwa_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 588858]} lpqtvrigtattyapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipslka kkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgst qeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyafa gpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvygd
Timeline for d6mkwa_: