Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (3 species) |
Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries) |
Domain d6nfuc_: 6nfu C: [372578] Other proteins in same PDB: d6nfua1, d6nfua2, d6nfub1, d6nfub2 automated match to d1r3jc_ complexed with 1em, f09, k; mutant |
PDB Entry: 6nfu (more details), 2.09 Å
SCOPe Domain Sequences for d6nfuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nfuc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvaygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d6nfuc_:
View in 3D Domains from other chains: (mouse over for more information) d6nfua1, d6nfua2, d6nfub1, d6nfub2 |