Lineage for d6nfuc_ (6nfu C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023599Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 3023620Protein Potassium channel protein [56901] (3 species)
  7. 3023663Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries)
  8. 3023674Domain d6nfuc_: 6nfu C: [372578]
    Other proteins in same PDB: d6nfua1, d6nfua2, d6nfub1, d6nfub2
    automated match to d1r3jc_
    complexed with 1em, f09, k; mutant

Details for d6nfuc_

PDB Entry: 6nfu (more details), 2.09 Å

PDB Description: structure of the kcsa-g77a mutant or the 2,4-ion bound configuration of a k+ channel selectivity filter.
PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d6nfuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nfuc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvaygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d6nfuc_:

Click to download the PDB-style file with coordinates for d6nfuc_.
(The format of our PDB-style files is described here.)

Timeline for d6nfuc_: