Lineage for d6k4ta_ (6k4t A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603927Species Serratia marcescens [TaxId:615] [193993] (9 PDB entries)
  8. 2603932Domain d6k4ta_: 6k4t A: [372559]
    automated match to d4ax1b_
    complexed with jke, so4, trs, zn

Details for d6k4ta_

PDB Entry: 6k4t (more details), 1.39 Å

PDB Description: crystal structure of smb-1 metallo-beta-lactamase in a complex with tsa
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d6k4ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k4ta_ d.157.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}
rdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgfkl
sdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnfpg
sakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavsad
syrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdngac
raiaaagrkrletrlasekr

SCOPe Domain Coordinates for d6k4ta_:

Click to download the PDB-style file with coordinates for d6k4ta_.
(The format of our PDB-style files is described here.)

Timeline for d6k4ta_: