Lineage for d6mlda_ (6mld A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521698Protein Lysine-,arginine-,ornithine-binding (LAO) protein [53856] (4 species)
  7. 2521711Species Salmonella typhimurium [TaxId:99287] [372533] (12 PDB entries)
  8. 2521714Domain d6mlda_: 6mld A: [372545]
    automated match to d1lsta_
    complexed with act; mutant

Details for d6mlda_

PDB Entry: 6mld (more details), 1.66 Å

PDB Description: crystal structure of the periplasmic lysine-, arginine-, ornithine- binding protein (lao) f52a mutant from salmonella typhimurium
PDB Compounds: (A:) Lysine/arginine/ornithine-binding periplasmic protein

SCOPe Domain Sequences for d6mlda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mlda_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 99287]}
alpqtvrigtdttyapfsskdakgefigfdidlgnemckrmqvkctwvasdadalipslk
akkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgs
tqeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyaf
agpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvygd

SCOPe Domain Coordinates for d6mlda_:

Click to download the PDB-style file with coordinates for d6mlda_.
(The format of our PDB-style files is described here.)

Timeline for d6mlda_: