Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein Lysine-,arginine-,ornithine-binding (LAO) protein [53856] (4 species) |
Species Salmonella typhimurium [TaxId:99287] [372533] (12 PDB entries) |
Domain d6mlda_: 6mld A: [372545] automated match to d1lsta_ complexed with act; mutant |
PDB Entry: 6mld (more details), 1.66 Å
SCOPe Domain Sequences for d6mlda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mlda_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 99287]} alpqtvrigtdttyapfsskdakgefigfdidlgnemckrmqvkctwvasdadalipslk akkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgs tqeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyaf agpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvygd
Timeline for d6mlda_: