Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Streptomyces blastmyceticus [TaxId:68180] [372527] (3 PDB entries) |
Domain d6j83a_: 6j83 A: [372532] automated match to d1uedb_ complexed with b9r, hem |
PDB Entry: 6j83 (more details), 1.9 Å
SCOPe Domain Sequences for d6j83a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j83a_ a.104.1.0 (A:) automated matches {Streptomyces blastmyceticus [TaxId: 68180]} plsypfneavaldvdplyaklraeepvvrvscpfgedawlvtshadmktiladprfsral aaehdesrltplpihtsilgmdspdhtrlrrllakvftmrrvellrprieqeadrlidal iaegppgdlmegfavpfagtvvcdllgvpfedreqfrgwldafsattvmteeeieadter lhgyiaqlmvrrraepqddlisamvkasdeeeklsekelvelasvlliaghetvssqlid slhvlfthpeqlrllkdrpelmpgtveelmrfvplishvtfaryatedvelsgtlvrage svlpaipsanrdesvfenadrfdltrehnphlgfgygihrclgaplarlemqvaldsllr rlpelrcavpaeslewkdgmqvrsllelpvlw
Timeline for d6j83a_: