Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (18 species) not a true protein |
Species Novosphingobium sp. [TaxId:164608] [372398] (3 PDB entries) |
Domain d6p3hd1: 6p3h D:8-174 [372480] Other proteins in same PDB: d6p3ha3, d6p3hb3, d6p3hc3, d6p3hd3 automated match to d3g7ka1 complexed with cl, nqm |
PDB Entry: 6p3h (more details), 1.62 Å
SCOPe Domain Sequences for d6p3hd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p3hd1 d.21.1.0 (D:8-174) automated matches {Novosphingobium sp. [TaxId: 164608]} mdsapcmwmrggtskggyflradlpadtaardafllavmgspdprqidgmggadpltsmv avvskserpgidvdylflqvfvdqaivtdaqncgnilagvgpfaierglvaasgdetrva ifmentgqvavatvrtpggsvtyagdaaidgvpgthapiptefrdta
Timeline for d6p3hd1: