SCOPe 2.07: Domain d6p3wb2: 6p3w B:310-432

Lineage for d6p3wb2 (6p3w B:310-432)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
   Uniprot P20248 175-432

8. Domain d6p3wb2: 6p3w B:310-432 [372479]
   Other proteins in same PDB: d6p3wa_, d6p3wc_
   automated match to d4eojb2
   complexed with po4

Details for d6p3wb2

PDB Entry: 6p3w, 2.54 Å

PDB Description: crystal structure of the cyclin a-cdk2-orc1 complex

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d6p3wb2:

Sequence; same for both SEQRES and ATOM records:

>d6p3wb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d6p3wb2:

• d6p3wb2 is new in SCOPe 2.07-stable
  
• d6p3wb2 appears in the current release, SCOPe 2.08