Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.22: ASF1-like [101546] (2 families) contains extra C-terminal strand automatically mapped to Pfam PF04729 |
Family b.1.22.1: ASF1-like [101547] (2 proteins) |
Protein automated matches [195145] (3 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:559292] [347659] (6 PDB entries) |
Domain d6o22d1: 6o22 D:2-164 [372370] Other proteins in same PDB: d6o22d2, d6o22f_ automated match to d2cu9a1 |
PDB Entry: 6o22 (more details)
SCOPe Domain Sequences for d6o22d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o22d1 b.1.22.1 (D:2-164) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee lrenppakvqvdhivrnilaekprvtrfnivwdnenegdlypp
Timeline for d6o22d1: