Lineage for d6h2ua1 (6h2u A:3-209)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502371Species Human (Homo sapiens) [TaxId:9606] [187871] (32 PDB entries)
  8. 2502382Domain d6h2ua1: 6h2u A:3-209 [372262]
    Other proteins in same PDB: d6h2ua2
    automated match to d1wy7c_
    protein/RNA complex; complexed with edo, sam, so4

Details for d6h2ua1

PDB Entry: 6h2u (more details), 1.6 Å

PDB Description: crystal structure of human mettl5-trmt112 complex, the 18s rrna m6a1832 methyltransferase at 1.6a resolution
PDB Compounds: (A:) Methyltransferase-like protein 5

SCOPe Domain Sequences for d6h2ua1:

Sequence, based on SEQRES records: (download)

>d6h2ua1 c.66.1.0 (A:3-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvrlkelesrlqqvdgfekpkllleqyptrphiaacmlytihntyddienkvvadlgcgc
gvlsigtamlgaglcvgfdidedaleifnrnaeefeltnidmvqcdvcllsnrmsksfdt
vimnppfgtknnkgtdmaflktalemartavyslhksstrehvqkkaaewkikidiiael
rydlpasykfhkkksvdievdlirfsf

Sequence, based on observed residues (ATOM records): (download)

>d6h2ua1 c.66.1.0 (A:3-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvrlkelesrlqqvdgfekpkllleqyptrphiaacmlytihntyddienkvvadlgcgc
gvlsigtamlgaglcvgfdidedaleifnrnaeefeltnidmvqcdvcllsnrmsksfdt
vimnppfgtknnkgtdmaflktalemartavyslhksstrehvqkkaaewkikidiiael
rydlpasyvdievdlirfsf

SCOPe Domain Coordinates for d6h2ua1:

Click to download the PDB-style file with coordinates for d6h2ua1.
(The format of our PDB-style files is described here.)

Timeline for d6h2ua1: