Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (19 species) |
Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (38 PDB entries) |
Domain d5zjec1: 5zje C:1-159 [372191] Other proteins in same PDB: d5zjea2, d5zjeb2, d5zjec2, d5zjed2, d5zjee2, d5zjef2, d5zjeg2, d5zjeh2, d5zjei2, d5zjej2, d5zjek2, d5zjel2 automated match to d4jnka1 complexed with mli |
PDB Entry: 5zje (more details), 2.93 Å
SCOPe Domain Sequences for d5zjec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zjec1 c.2.1.5 (C:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]} atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig
Timeline for d5zjec1: