Lineage for d6phel_ (6phe L:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467829Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467830Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2467957Family c.24.1.0: automated matches [347767] (1 protein)
    not a true family
  6. 2467958Protein automated matches [347768] (3 species)
    not a true protein
  7. 2467972Species Elizabethkingia anophelis [TaxId:1338011] [372032] (1 PDB entry)
  8. 2467984Domain d6phel_: 6phe L: [372124]
    automated match to d1b93a_
    complexed with mpd, po4

Details for d6phel_

PDB Entry: 6phe (more details), 2.1 Å

PDB Description: crystal structure of methylglyoxal synthase from elizabethkingia anophelis nuhp1
PDB Compounds: (L:) methylglyoxal synthase

SCOPe Domain Sequences for d6phel_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6phel_ c.24.1.0 (L:) automated matches {Elizabethkingia anophelis [TaxId: 1338011]}
sirtlperktialvahdhkkddlvrwvqkhagkltkhnliatgttgklieedlgvevkrv
msgplggdqqlgsmiaqrqidiviffwdpmeaqphdsdvkafirlcvvwntpmacdsata
dfilsspfmeteyqaeipdydgylkrnipea

SCOPe Domain Coordinates for d6phel_:

Click to download the PDB-style file with coordinates for d6phel_.
(The format of our PDB-style files is described here.)

Timeline for d6phel_: