Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) contains a common phosphate-binding site |
Family c.24.1.0: automated matches [347767] (1 protein) not a true family |
Protein automated matches [347768] (3 species) not a true protein |
Species Elizabethkingia anophelis [TaxId:1338011] [372032] (1 PDB entry) |
Domain d6phel_: 6phe L: [372124] automated match to d1b93a_ complexed with mpd, po4 |
PDB Entry: 6phe (more details), 2.1 Å
SCOPe Domain Sequences for d6phel_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6phel_ c.24.1.0 (L:) automated matches {Elizabethkingia anophelis [TaxId: 1338011]} sirtlperktialvahdhkkddlvrwvqkhagkltkhnliatgttgklieedlgvevkrv msgplggdqqlgsmiaqrqidiviffwdpmeaqphdsdvkafirlcvvwntpmacdsata dfilsspfmeteyqaeipdydgylkrnipea
Timeline for d6phel_: