SCOPe 2.07: Domain d6rpgb_: 6rpg B:

Lineage for d6rpgb_ (6rpg B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6rpgb_: 6rpg B: [372111]
   automated match to d5x8ma_
   complexed with kdw

Details for d6rpgb_

PDB Entry: 6rpg, 2.7 Å

PDB Description: structure of human programmed cell death 1 ligand 1 (pd-l1) with inhibitor

PDB Compounds: (B:) Programmed cell death 1 ligand 1

SCOPe Domain Sequences for d6rpgb_:

Sequence; same for both SEQRES and ATOM records:

>d6rpgb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvq
hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapy

Timeline for d6rpgb_:

• d6rpgb_ is new in SCOPe 2.07-stable
  
• d6rpgb_ appears in the current release, SCOPe 2.08