SCOPe 2.07: Domain d6pnma2: 6pnm A:103-241

Lineage for d6pnma2 (6pnm A:103-241)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class omega GST [81352] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47632] (17 PDB entries)

8. Domain d6pnma2: 6pnm A:103-241 [372074]
   Other proteins in same PDB: d6pnma1
   automated match to d1eema1
   complexed with so4, tla, xx0

Details for d6pnma2

PDB Entry: 6pnm, 1.82 Å

PDB Description: human gsto1-1 complexed with 2-chloro-n-(4-chloro-3- (morpholinosulfonyl)phenyl)acetamide

PDB Compounds: (A:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d6pnma2:

Sequence; same for both SEQRES and ATOM records:

>d6pnma2 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt
tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw
qgflelylqnspeacdygl

Timeline for d6pnma2:

• d6pnma2 is new in SCOPe 2.07-stable
  
• d6pnma2 appears in the current release, SCOPe 2.08