Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (47 species) not a true protein |
Species Trichoplusia ni [TaxId:7111] [371987] (1 PDB entry) |
Domain d6or9c2: 6or9 C:193-364 [371992] Other proteins in same PDB: d6or9a1, d6or9b1, d6or9c1, d6or9d1 automated match to d1i0za2 |
PDB Entry: 6or9 (more details), 1.8 Å
SCOPe Domain Sequences for d6or9c2:
Sequence, based on SEQRES records: (download)
>d6or9c2 d.162.1.0 (C:193-364) automated matches {Trichoplusia ni [TaxId: 7111]} sgtnldsarfryllseklgiattschgyiigehgdssvpvwsgvniagvrlsdlnqkigs dsdpenwkethtmvvksayeviklkgytswaiglslsqlarailsnansvhavstylkge hdindevflslpcvlgrsgvcdvirqpltqtersqlhqsadlmakvqagikf
>d6or9c2 d.162.1.0 (C:193-364) automated matches {Trichoplusia ni [TaxId: 7111]} sgtnldsarfryllseklgiattschgyiigehgdssvpvwsgvniagvrlsdlnqknwk ethtmvvksayeviklkgytswaiglslsqlarailsnansvhavstylkgehdindevf lslpcvlgrsgvcdvirqpltqtersqlhqsadlmakvqagikf
Timeline for d6or9c2: