Lineage for d6or9c2 (6or9 C:193-364)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2605462Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2605463Protein automated matches [226850] (47 species)
    not a true protein
  7. 2605763Species Trichoplusia ni [TaxId:7111] [371987] (1 PDB entry)
  8. 2605766Domain d6or9c2: 6or9 C:193-364 [371992]
    Other proteins in same PDB: d6or9a1, d6or9b1, d6or9c1, d6or9d1
    automated match to d1i0za2

Details for d6or9c2

PDB Entry: 6or9 (more details), 1.8 Å

PDB Description: structure of l-lactate dehydrogenase from trichoplusia ni
PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6or9c2:

Sequence, based on SEQRES records: (download)

>d6or9c2 d.162.1.0 (C:193-364) automated matches {Trichoplusia ni [TaxId: 7111]}
sgtnldsarfryllseklgiattschgyiigehgdssvpvwsgvniagvrlsdlnqkigs
dsdpenwkethtmvvksayeviklkgytswaiglslsqlarailsnansvhavstylkge
hdindevflslpcvlgrsgvcdvirqpltqtersqlhqsadlmakvqagikf

Sequence, based on observed residues (ATOM records): (download)

>d6or9c2 d.162.1.0 (C:193-364) automated matches {Trichoplusia ni [TaxId: 7111]}
sgtnldsarfryllseklgiattschgyiigehgdssvpvwsgvniagvrlsdlnqknwk
ethtmvvksayeviklkgytswaiglslsqlarailsnansvhavstylkgehdindevf
lslpcvlgrsgvcdvirqpltqtersqlhqsadlmakvqagikf

SCOPe Domain Coordinates for d6or9c2:

Click to download the PDB-style file with coordinates for d6or9c2.
(The format of our PDB-style files is described here.)

Timeline for d6or9c2: