Lineage for d6ispa1 (6isp A:1-315)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508322Family c.69.1.17: Fungal lipases [53558] (5 proteins)
  6. 2508473Protein automated matches [190510] (9 species)
    not a true protein
  7. 2508499Species Pseudozyma antarctica [TaxId:84753] [371852] (8 PDB entries)
  8. 2508512Domain d6ispa1: 6isp A:1-315 [371868]
    Other proteins in same PDB: d6ispa2, d6ispb2, d6ispc2, d6ispd2
    automated match to d5a6va_
    complexed with ca, cpq; mutant

Details for d6ispa1

PDB Entry: 6isp (more details), 1.88 Å

PDB Description: structure of candida antarctica lipase b mutant
PDB Compounds: (A:) lipase b

SCOPe Domain Sequences for d6ispa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ispa1 c.69.1.17 (A:1-315) automated matches {Pseudozyma antarctica [TaxId: 84753]}
lpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaqlg
ytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvsqgglvaqwgltffps
irskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqivptt
nlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrsa
lrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepdlmpy
arpfavgkrtcsgiv

SCOPe Domain Coordinates for d6ispa1:

Click to download the PDB-style file with coordinates for d6ispa1.
(The format of our PDB-style files is described here.)

Timeline for d6ispa1: