Lineage for d6fg2l2 (6fg2 L:106-211)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2363248Domain d6fg2l2: 6fg2 L:106-211 [371826]
    Other proteins in same PDB: d6fg2e1, d6fg2g1, d6fg2l1, d6fg2m1
    automated match to d5gz0a2
    complexed with nag

Details for d6fg2l2

PDB Entry: 6fg2 (more details), 2.79 Å

PDB Description: crystal structure of fab of natalizumab in complex with fab of naa84.
PDB Compounds: (L:) light chain fab natalizumab

SCOPe Domain Sequences for d6fg2l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fg2l2 b.1.1.2 (L:106-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d6fg2l2:

Click to download the PDB-style file with coordinates for d6fg2l2.
(The format of our PDB-style files is described here.)

Timeline for d6fg2l2: