Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Diaphorobacter sp. [TaxId:1302548] [367955] (3 PDB entries) |
Domain d5zsxa2: 5zsx A:143-314 [371727] automated match to d3hq0c2 complexed with 3fa, ca, edo, fe, peg |
PDB Entry: 5zsx (more details), 2.2 Å
SCOPe Domain Sequences for d5zsxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zsxa2 d.32.1.0 (A:143-314) automated matches {Diaphorobacter sp. [TaxId: 1302548]} agahwldhcllvcemnpeagintvadntrfvtecldfflteqvlvgpggsiqattflart ttphdiafvggptsglhhiaffldswhdvlkaadvmaknkvridvaptrhgitrgetiyf fdpsgnrnetfaglgylaqrdrpvttwtedqlgsaifyhtgylepsftdvyt
Timeline for d5zsxa2: