Lineage for d5zsxa2 (5zsx A:143-314)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549945Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2549946Protein automated matches [190239] (26 species)
    not a true protein
  7. 2549983Species Diaphorobacter sp. [TaxId:1302548] [367955] (3 PDB entries)
  8. 2549985Domain d5zsxa2: 5zsx A:143-314 [371727]
    automated match to d3hq0c2
    complexed with 3fa, ca, edo, fe, peg

Details for d5zsxa2

PDB Entry: 5zsx (more details), 2.2 Å

PDB Description: catechol 2,3-dioxygenase with 3-fluorocatechol from diaphorobacter sp ds2
PDB Compounds: (A:) Catechol 2,3-dioxygenase, extradiol protein

SCOPe Domain Sequences for d5zsxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zsxa2 d.32.1.0 (A:143-314) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
agahwldhcllvcemnpeagintvadntrfvtecldfflteqvlvgpggsiqattflart
ttphdiafvggptsglhhiaffldswhdvlkaadvmaknkvridvaptrhgitrgetiyf
fdpsgnrnetfaglgylaqrdrpvttwtedqlgsaifyhtgylepsftdvyt

SCOPe Domain Coordinates for d5zsxa2:

Click to download the PDB-style file with coordinates for d5zsxa2.
(The format of our PDB-style files is described here.)

Timeline for d5zsxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zsxa1