Lineage for d5zeea_ (5zee A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481831Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2481832Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2482296Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 2482297Protein automated matches [190626] (12 species)
    not a true protein
  7. 2482346Species Entamoeba histolytica [TaxId:5759] [371684] (3 PDB entries)
  8. 2482347Domain d5zeea_: 5zee A: [371685]
    Other proteins in same PDB: d5zeeb2
    automated match to d2ceva_
    complexed with edo, har, mn

Details for d5zeea_

PDB Entry: 5zee (more details), 1.74 Å

PDB Description: crystal structure of entamoeba histolytica arginase in complex with n(omega)-hydroxy-l-arginine (noha) at 1.74 a
PDB Compounds: (A:) arginase

SCOPe Domain Sequences for d5zeea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zeea_ c.42.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 5759]}
mqfekvtyiavpqkygqkkvgveegpkfleklgfmnvleqvaksvnkktitepktpqelg
vtnarnlnevesvnielrdtiakeydvnnlliniggdhsiglgtiagvvkamkpnarvgv
vwfdahpdmntpenspsgnihgmplacavglgpqrltsimphyitpkdimyvgirsidvg
eqfeiqdkhidhftaedvkrvgmkevieainkkfvdydvihlsfdidgidpefilgtgtp
vpkgisledslyfmsemgkmkklhsvdiveynpkieeeitgknvlkcisslfgik

SCOPe Domain Coordinates for d5zeea_:

Click to download the PDB-style file with coordinates for d5zeea_.
(The format of our PDB-style files is described here.)

Timeline for d5zeea_: