Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.0: automated matches [191435] (1 protein) not a true family |
Protein automated matches [190626] (12 species) not a true protein |
Species Entamoeba histolytica [TaxId:5759] [371684] (3 PDB entries) |
Domain d5zeea_: 5zee A: [371685] Other proteins in same PDB: d5zeeb2 automated match to d2ceva_ complexed with edo, har, mn |
PDB Entry: 5zee (more details), 1.74 Å
SCOPe Domain Sequences for d5zeea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zeea_ c.42.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 5759]} mqfekvtyiavpqkygqkkvgveegpkfleklgfmnvleqvaksvnkktitepktpqelg vtnarnlnevesvnielrdtiakeydvnnlliniggdhsiglgtiagvvkamkpnarvgv vwfdahpdmntpenspsgnihgmplacavglgpqrltsimphyitpkdimyvgirsidvg eqfeiqdkhidhftaedvkrvgmkevieainkkfvdydvihlsfdidgidpefilgtgtp vpkgisledslyfmsemgkmkklhsvdiveynpkieeeitgknvlkcisslfgik
Timeline for d5zeea_: