SCOPe 2.07: Domain d6rl0b2: 6rl0 B:508-638

Lineage for d6rl0b2 (6rl0 B:508-638)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (29 species)
   not a true protein

7. Species Pseudomonas stutzeri [TaxId:316] [226186] (22 PDB entries)

8. Domain d6rl0b2: 6rl0 B:508-638 [371634]
   Other proteins in same PDB: d6rl0a1, d6rl0b1, d6rl0c1, d6rl0d1
   automated match to d3sbqa2
   complexed with b3p, ca, cl, cua, cuk, fmt, k, na

Details for d6rl0b2

PDB Entry: 6rl0, 1.78 Å

PDB Description: recombinant pseudomonas stutzeri nitrous oxide reductase, form i

PDB Compounds: (B:) nitrous-oxide reductase

SCOPe Domain Sequences for d6rl0b2:

Sequence; same for both SEQRES and ATOM records:

>d6rl0b2 b.6.1.0 (B:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]}
kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde
vtvtitnidqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm
emvgrmmvepa

Timeline for d6rl0b2:

• d6rl0b2 is new in SCOPe 2.07-stable
  
• d6rl0b2 appears in the current release, SCOPe 2.08