SCOPe 2.07: Domain d6ryta_: 6ryt A:

Lineage for d6ryta_ (6ryt A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (77 PDB entries)
   Uniprot P02754

8. Domain d6ryta_: 6ryt A: [371618]
   automated match to d5htda_
   complexed with gol, po4

Details for d6ryta_

PDB Entry: 6ryt, 2.1 Å

PDB Description: engineered beta-lactoglobulin: variant m107l

PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d6ryta_:

Sequence, based on SEQRES records:

>d6ryta_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
vtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwe
ngecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfclensaepeqslacqcl
vrtpevddealekfdkalkalpmhirlsfnptqleeqc

Sequence, based on observed residues (ATOM records):

>d6ryta_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
vtqtmgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwca
qkkiiaektkipavfkidaenkvlvldtdykkyllfclensslacqclvrtpevddeale
kfdkalkalpmhirlsfnptqleec

Timeline for d6ryta_:

• d6ryta_ is new in SCOPe 2.07-stable
  
• d6ryta_ appears in the current release, SCOPe 2.08