Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold |
Family c.49.2.0: automated matches [191450] (1 protein) not a true family |
Protein automated matches [190687] (6 species) not a true protein |
Species Polytomella sp. [TaxId:37502] [371495] (16 PDB entries) |
Domain d6reps_: 6rep S: [371558] automated match to d2v7qg_ complexed with adp, atp, mg, zn |
PDB Entry: 6rep (more details), 3.1 Å
SCOPe Domain Sequences for d6reps_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6reps_ c.49.2.0 (S:) automated matches {Polytomella sp. [TaxId: 37502]} snqavkqriraiknigkitkamkmvaaskmknaqiaveqsrglvdpfvrlfgdfpavnsn ksvvvavtsdkglcgglnsnitkytratlattesegkdvvvvsigdkgrsqltriesqry qlaiadtykvrvtfgqasliveelikhnpqsyqilfnkfrsaisfkptvatilspdllek qledvtgnsldaydieashersdvlrdltefhlgvtlynamlenncsehasrmsamenst ksagemlgkltldynrkrqatittelieiiagasalm
Timeline for d6reps_: