Lineage for d6reps_ (6rep S:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488765Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2488928Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2488973Family c.49.2.0: automated matches [191450] (1 protein)
    not a true family
  6. 2488974Protein automated matches [190687] (6 species)
    not a true protein
  7. 2488987Species Polytomella sp. [TaxId:37502] [371495] (16 PDB entries)
  8. 2489000Domain d6reps_: 6rep S: [371558]
    automated match to d2v7qg_
    complexed with adp, atp, mg, zn

Details for d6reps_

PDB Entry: 6rep (more details), 3.1 Å

PDB Description: cryo-em structure of polytomella f-atp synthase, primary rotary state 3, composite map
PDB Compounds: (S:) ATP synthase gamma chain, mitochondrial

SCOPe Domain Sequences for d6reps_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6reps_ c.49.2.0 (S:) automated matches {Polytomella sp. [TaxId: 37502]}
snqavkqriraiknigkitkamkmvaaskmknaqiaveqsrglvdpfvrlfgdfpavnsn
ksvvvavtsdkglcgglnsnitkytratlattesegkdvvvvsigdkgrsqltriesqry
qlaiadtykvrvtfgqasliveelikhnpqsyqilfnkfrsaisfkptvatilspdllek
qledvtgnsldaydieashersdvlrdltefhlgvtlynamlenncsehasrmsamenst
ksagemlgkltldynrkrqatittelieiiagasalm

SCOPe Domain Coordinates for d6reps_:

Click to download the PDB-style file with coordinates for d6reps_.
(The format of our PDB-style files is described here.)

Timeline for d6reps_: