Lineage for d6qlvd_ (6qlv D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472664Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2472665Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2472704Family c.34.1.0: automated matches [191535] (1 protein)
    not a true family
  6. 2472705Protein automated matches [190910] (9 species)
    not a true protein
  7. 2472731Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189793] (14 PDB entries)
  8. 2472748Domain d6qlvd_: 6qlv D: [371456]
    automated match to d4zava_
    complexed with act, fmn, hjn, hzz, na, po4

Details for d6qlvd_

PDB Entry: 6qlv (more details), 2.39 Å

PDB Description: crystal structure of w200h ubix in complex with a geranyl-fmn n5 adduct
PDB Compounds: (D:) Flavin prenyltransferase UbiX

SCOPe Domain Sequences for d6qlvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qlvd_ c.34.1.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
msgperitlamtgasgaqyglrlldclvqeerevhfliskaaqlvmatetdvalpakpqa
mqaflteycgaaagqirvfgqndwmappasgssapnamvicpcstgtlsavatgacnnli
eraadvalkerrplvlvpreapfssihlenmlklsnlgavilpaapgfyhqpqsvedlvd
fvvarilntlgipqd

SCOPe Domain Coordinates for d6qlvd_:

Click to download the PDB-style file with coordinates for d6qlvd_.
(The format of our PDB-style files is described here.)

Timeline for d6qlvd_: