Lineage for d6oyhh1 (6oyh H:1-125)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2356301Domain d6oyhh1: 6oyh H:1-125 [371438]
    Other proteins in same PDB: d6oyhe2, d6oyhh2
    automated match to d4w81a_
    complexed with nk4

Details for d6oyhh1

PDB Entry: 6oyh (more details), 2.95 Å

PDB Description: crystal structure of mray bound to carbacaprazamycin
PDB Compounds: (H:) MraYAA nanobody

SCOPe Domain Sequences for d6oyhh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oyhh1 b.1.1.1 (H:1-125) automated matches {Llama (Lama glama) [TaxId: 9844]}
dvqlqesggglvqtggsltlscatsgrsfslyamawfrqapgkerefvagvsrrgntaya
davkgrftisrdnaantvylqmtslkpedtavyfcaafrvavttytsqqaneynywgqgt
qvtvs

SCOPe Domain Coordinates for d6oyhh1:

Click to download the PDB-style file with coordinates for d6oyhh1.
(The format of our PDB-style files is described here.)

Timeline for d6oyhh1: