Lineage for d1smna_ (1smn A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) Superfamily d.4.1: His-Me finger endonucleases [54060] (4 families) 
Family d.4.1.2: Sm endonuclease [54066] (1 protein) Protein Sm endonuclease [54067] (1 species) Species Serratia marcescens [TaxId:615] [54068] (4 PDB entries) 
Domain d1smna_: 1smn A: [37143]
Details for d1smna_
PDB Entry: 1smn (more details), 2.1 Å
PDB Description: identification of the serratia endonuclease dimer: structural basis and implications for catalysis
SCOP Domain Sequences for d1smna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smna_ d.4.1.2 (A:) Sm endonuclease {Serratia marcescens}
sidncavgcptggssnvsivrhaytlnnnsttkfanwvayhitkdtpasgktrnwktdpa
lnpadtlapadytganaalkvdrghqaplaslagvsdweslnylsnitpqksdlnqgawa
rledqerklidradissvytvtgplyerdmgklpgtqkahtipsaywkvifinnspavnh
yaaflfdqntpkgadfcqfrvtvdeiekrtgliiwaglpddvqaslkskpgvlpelmgck
n
SCOP Domain Coordinates for d1smna_:
Click to download the PDB-style file with coordinates for d1smna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1smna_:
- d1smna_ appears in SCOP 1.57
- d1smna_ appears in the current release, SCOPe 2.08
View in 3D
