Lineage for d1qaea_ (1qae A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) Superfamily d.4.1: His-Me finger endonucleases [54060] (4 families) 
Family d.4.1.2: Sm endonuclease [54066] (1 protein) Protein Sm endonuclease [54067] (1 species) Species Serratia marcescens [TaxId:615] [54068] (4 PDB entries) 
Domain d1qaea_: 1qae A: [37141]
Details for d1qaea_
PDB Entry: 1qae (more details), 2.05 Å
PDB Description: the active site of serratia endonuclease contains a conserved magnesium-water cluster
SCOP Domain Sequences for d1qaea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qaea_ d.4.1.2 (A:) Sm endonuclease {Serratia marcescens}
idncavgcptggssnvsivrhaytlnnnsttkfanwvayhitkdtpasgktrnwktdpal
npadtlapadytganaalkvdrghqaplaslagvsdweslnylsnitpqksdlnqgawar
ledqerklidradissvytvtgplyerdmgklpgtqkahtipsaywkvifinnspavnhy
aaflfdqntpkgadfcqfrvtvdeiekrtgliiwaglpddvqaslkskpgvlpelmgckn
SCOP Domain Coordinates for d1qaea_:
Click to download the PDB-style file with coordinates for d1qaea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qaea_:
- d1qaea_ appears in SCOP 1.57
- d1qaea_ appears in the current release, SCOPe 2.08
View in 3D
