Lineage for d6outb_ (6out B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431548Family b.121.4.3: Caliciviridae-like VP [88637] (2 proteins)
  6. 2431554Protein automated matches [371188] (1 species)
    not a true protein
  7. 2431555Species Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId:524364] [371189] (1 PDB entry)
  8. 2431557Domain d6outb_: 6out B: [371248]
    automated match to d1ihmb_

Details for d6outb_

PDB Entry: 6out (more details), 2.6 Å

PDB Description: asymmetric focused reconstruction of human norovirus gi.1 norwalk strain vlp asymmetric unit in t=3 symmetry
PDB Compounds: (B:) Capsid protein VP1

SCOPe Domain Sequences for d6outb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6outb_ b.121.4.3 (B:) automated matches {Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId: 524364]}
tssvdgasgagqlvpevnasdplamdpvagsstavatagqvnpidpwiinnfvqapqgef
tispnntpgdvlfdlslgphlnpfllhlsqmyngwvgnmrvrimlagnaftagkiivsci
ppgfgshnltiaqatlfphviadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlyt
plrtgggtgdsfvvagrvmtcpspdfnflflvpptveqktrpftlpnlplsslsnsrapl
pissmgispdnvqsvqfqngrctldgrlvgttpvslshvakirgtsngtvinlteldgtp
fhpfegpapigfpdlggcdwhinmtqfghssqtqydvdttpdtfvphlgsiqangigsgn
yvgvlswisppshpsgsqvdlwkipnygssiteathlapsvyppgfgevlvffmskmpgp
gaynlpcllpqeyishlaseqaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpnga
ssgpqqlpingvfvfvswvsrfyqlkpvgta

SCOPe Domain Coordinates for d6outb_:

Click to download the PDB-style file with coordinates for d6outb_.
(The format of our PDB-style files is described here.)

Timeline for d6outb_: