Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.3: Caliciviridae-like VP [88637] (2 proteins) |
Protein automated matches [371188] (1 species) not a true protein |
Species Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId:524364] [371189] (1 PDB entry) |
Domain d6outb_: 6out B: [371248] automated match to d1ihmb_ |
PDB Entry: 6out (more details), 2.6 Å
SCOPe Domain Sequences for d6outb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6outb_ b.121.4.3 (B:) automated matches {Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId: 524364]} tssvdgasgagqlvpevnasdplamdpvagsstavatagqvnpidpwiinnfvqapqgef tispnntpgdvlfdlslgphlnpfllhlsqmyngwvgnmrvrimlagnaftagkiivsci ppgfgshnltiaqatlfphviadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlyt plrtgggtgdsfvvagrvmtcpspdfnflflvpptveqktrpftlpnlplsslsnsrapl pissmgispdnvqsvqfqngrctldgrlvgttpvslshvakirgtsngtvinlteldgtp fhpfegpapigfpdlggcdwhinmtqfghssqtqydvdttpdtfvphlgsiqangigsgn yvgvlswisppshpsgsqvdlwkipnygssiteathlapsvyppgfgevlvffmskmpgp gaynlpcllpqeyishlaseqaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpnga ssgpqqlpingvfvfvswvsrfyqlkpvgta
Timeline for d6outb_: