Lineage for d6ow4h_ (6ow4 H:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454571Species Bifidobacterium adolescentis [TaxId:411481] [370577] (2 PDB entries)
  8. 2454579Domain d6ow4h_: 6ow4 H: [371230]
    automated match to d3i3og_
    complexed with nad

Details for d6ow4h_

PDB Entry: 6ow4 (more details), 1.99 Å

PDB Description: structure of the nadh-bound form of 20beta-hydroxysteroid dehydrogenase from bifidobacterium adolescentis strain l2-32
PDB Compounds: (H:) Oxidoreductase, short chain dehydrogenase/reductase family protein

SCOPe Domain Sequences for d6ow4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ow4h_ c.2.1.0 (H:) automated matches {Bifidobacterium adolescentis [TaxId: 411481]}
tveqifderypldkwkdsnysildkfsmrgrkgfvtgaagglgrnaaaalaqagadvalv
dlpsqedkltelakdmserfgtnvialtcdvtdtvqvaelktqlveqlgtvdfaflnagv
nvpgddqdateevwtrtininlngtyrtgriaheimrehghggsliftaalsghnanymm
gsptpvnaygatkaaimehsrylaaalakdgirsntispgyvwsgifngridmpghdaml
evvpmhrfgtndeiastvlflasdassyvtgtdirvdggysvf

SCOPe Domain Coordinates for d6ow4h_:

Click to download the PDB-style file with coordinates for d6ow4h_.
(The format of our PDB-style files is described here.)

Timeline for d6ow4h_: