Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
Protein Transglutaminase catalytic domain [54045] (4 species) |
Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (8 PDB entries) Coagulation factor XIII |
Domain d1qrkb4: 1qrk B:191-507 [37120] Other proteins in same PDB: d1qrka1, d1qrka2, d1qrka3, d1qrkb1, d1qrkb2, d1qrkb3 complexed with sr |
PDB Entry: 1qrk (more details), 2.5 Å
SCOPe Domain Sequences for d1qrkb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qrkb4 d.3.1.4 (B:191-507) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]} davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee rlaletalmygakkpln
Timeline for d1qrkb4:
View in 3D Domains from other chains: (mouse over for more information) d1qrka1, d1qrka2, d1qrka3, d1qrka4 |