Lineage for d6op5c2 (6op5 C:237-391)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2525350Species Piper methysticum [TaxId:130404] [350817] (3 PDB entries)
  8. 2525356Domain d6op5c2: 6op5 C:237-391 [371177]
    automated match to d3wd8a2
    complexed with wca

Details for d6op5c2

PDB Entry: 6op5 (more details), 2.7 Å

PDB Description: crystal structure of piper methysticum styrylpyrone synthase 1 in complex with p-coumaroyl-coa
PDB Compounds: (C:) Styrylpyrone synthase 1

SCOPe Domain Sequences for d6op5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6op5c2 c.95.1.0 (C:237-391) automated matches {Piper methysticum [TaxId: 130404]}
lfqivsgaqtilpdsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdw
nsifwiahpggptildqveaklglkeeklkstravlreygnmssacvlfildevrkrsme
egktttgegfdwgvlfgfgpgftvetvvlhsmpip

SCOPe Domain Coordinates for d6op5c2:

Click to download the PDB-style file with coordinates for d6op5c2.
(The format of our PDB-style files is described here.)

Timeline for d6op5c2: