Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (22 species) not a true protein |
Species Snow mountain virus [TaxId:52276] [371166] (2 PDB entries) |
Domain d6otfc_: 6otf C: [371167] automated match to d1ihmb_ complexed with zn |
PDB Entry: 6otf (more details), 3.1 Å
SCOPe Domain Sequences for d6otfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6otfc_ b.121.4.0 (C:) automated matches {Snow mountain virus [TaxId: 52276]} vmalepvagaalaapvtgqtniidpwiranfvqapngeftvsprnapgevllnlelgpel npylahlarmyngyaggmevqvmlagnaftagklvfaavpphfpvenlspqqitmfphvi idvrtlepvllplpdvrnnffhynqkddpkmrivamlytplrsngsgddvftvscrvltr pspdfdftylvpptvesktkpftlpiltlgelsnsrfpvsidqmytspnevisvqcqngr ctldgelqgttqlqvsgicafkgevtahlqdndhlynititnlngspfdpsedipaplgv pdfqgrvfgvitqrdkqnaagqsqpanrghdavvptytaqytpklgqvqigtwqtddlkv nqpvkftpvglndtehfnqwvvpryagalnlntnlapsvapvfpgerllffrsylplkgg ygnpaidcllpqewvqhfyqeaapsmsevalvryinpdtgralfeaklhragfmtvssnt sapvvvpangyfrfdswvnqfyslapm
Timeline for d6otfc_: