Lineage for d6otfc_ (6otf C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431815Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2431816Protein automated matches [190988] (22 species)
    not a true protein
  7. 2431976Species Snow mountain virus [TaxId:52276] [371166] (2 PDB entries)
  8. 2431980Domain d6otfc_: 6otf C: [371167]
    automated match to d1ihmb_
    complexed with zn

Details for d6otfc_

PDB Entry: 6otf (more details), 3.1 Å

PDB Description: symmetric reconstruction of human norovirus gii.2 snow mountain virus strain vlp in t=3 symmetry
PDB Compounds: (C:) viral protein 1

SCOPe Domain Sequences for d6otfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6otfc_ b.121.4.0 (C:) automated matches {Snow mountain virus [TaxId: 52276]}
vmalepvagaalaapvtgqtniidpwiranfvqapngeftvsprnapgevllnlelgpel
npylahlarmyngyaggmevqvmlagnaftagklvfaavpphfpvenlspqqitmfphvi
idvrtlepvllplpdvrnnffhynqkddpkmrivamlytplrsngsgddvftvscrvltr
pspdfdftylvpptvesktkpftlpiltlgelsnsrfpvsidqmytspnevisvqcqngr
ctldgelqgttqlqvsgicafkgevtahlqdndhlynititnlngspfdpsedipaplgv
pdfqgrvfgvitqrdkqnaagqsqpanrghdavvptytaqytpklgqvqigtwqtddlkv
nqpvkftpvglndtehfnqwvvpryagalnlntnlapsvapvfpgerllffrsylplkgg
ygnpaidcllpqewvqhfyqeaapsmsevalvryinpdtgralfeaklhragfmtvssnt
sapvvvpangyfrfdswvnqfyslapm

SCOPe Domain Coordinates for d6otfc_:

Click to download the PDB-style file with coordinates for d6otfc_.
(The format of our PDB-style files is described here.)

Timeline for d6otfc_: