SCOPe 2.07: Domain d6ogxd1: 6ogx D:1-106

Lineage for d6ogxd1 (6ogx D:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6ogxd1: 6ogx D:1-106 [371144]
   Other proteins in same PDB: d6ogxd2, d6ogxg1, d6ogxg2, d6ogxg3, d6ogxl2
   automated match to d1dn0a1
   complexed with nag

Details for d6ogxd1

PDB Entry: 6ogx, 2.77 Å

PDB Description: ternary complex of ox40r (tnfrsf4) bound to fab1 and fab2

PDB Compounds: (D:) Fab1 Light Chain

SCOPe Domain Sequences for d6ogxd1:

Sequence; same for both SEQRES and ATOM records:

>d6ogxd1 b.1.1.0 (D:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdisnylnwyqqkpgkapklliyytsrlrsgvps
rfsgsgsgtdftltisslqpedfatyycqqghtlpptfgqgtkvei

Timeline for d6ogxd1:

• d6ogxd1 is new in SCOPe 2.07-stable
  
• d6ogxd1 appears in the current release, SCOPe 2.08