Lineage for d1f13a4 (1f13 A:191-515)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498098Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 498099Superfamily d.3.1: Cysteine proteinases [54001] (11 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 498322Family d.3.1.4: Transglutaminase catalytic domain [54044] (1 protein)
  6. 498323Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 498324Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (8 PDB entries)
    Coagulation factor XIII
  8. 498327Domain d1f13a4: 1f13 A:191-515 [37107]
    Other proteins in same PDB: d1f13a1, d1f13a2, d1f13a3, d1f13b1, d1f13b2, d1f13b3

Details for d1f13a4

PDB Entry: 1f13 (more details), 2.1 Å

PDB Description: recombinant human cellular coagulation factor xiii

SCOP Domain Sequences for d1f13a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f13a4 d.3.1.4 (A:191-515) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplntegvmksr

SCOP Domain Coordinates for d1f13a4:

Click to download the PDB-style file with coordinates for d1f13a4.
(The format of our PDB-style files is described here.)

Timeline for d1f13a4: