Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries) |
Domain d6o61d2: 6o61 D:244-431 [371051] Other proteins in same PDB: d6o61a1, d6o61b1, d6o61c1, d6o61d1, d6o61e_, d6o61f1, d6o61f2 automated match to d3rycd2 complexed with acp, ca, gdp, gtp, kum, mes, mg |
PDB Entry: 6o61 (more details), 2.6 Å
SCOPe Domain Sequences for d6o61d2:
Sequence, based on SEQRES records: (download)
>d6o61d2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatad
>d6o61d2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]} gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad
Timeline for d6o61d2: