Lineage for d6nlhd_ (6nlh D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2434696Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2434697Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2434698Protein Triosephosphate isomerase [51353] (21 species)
  7. 2434762Species Human (Homo sapiens) [TaxId:9606] [51355] (14 PDB entries)
  8. 2434790Domain d6nlhd_: 6nlh D: [370846]
    automated match to d2jk2b_
    complexed with br, na, po4

Details for d6nlhd_

PDB Entry: 6nlh (more details), 2.2 Å

PDB Description: structure of human triose phosphate isomerase r189a
PDB Compounds: (D:) triosephosphate isomerase

SCOPe Domain Sequences for d6nlhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nlhd_ c.1.1.1 (D:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
rkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiavaa
qncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklagwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvdi
inakq

SCOPe Domain Coordinates for d6nlhd_:

Click to download the PDB-style file with coordinates for d6nlhd_.
(The format of our PDB-style files is described here.)

Timeline for d6nlhd_: