SCOPe 2.08: Domain d6nhgd1: 6nhg D:1-195

Lineage for d6nhgd1 (6nhg D:1-195)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein Cytochrome bc1 domain [46677] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46678] (19 PDB entries)
   Uniprot P00125

8. Domain d6nhgd1: 6nhg D:1-195 [370829]
   Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgb1, d6nhgb2, d6nhgc1, d6nhgc2, d6nhgd2, d6nhge1, d6nhge2, d6nhgg_, d6nhgh_, d6nhgj_, d6nhgk_
   automated match to d1ntmd1
   complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3

Details for d6nhgd1

PDB Entry: 6nhg, 2.8 Å

PDB Description: rhodobacter sphaeroides mitochondrial respiratory chain complex

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d6nhgd1:

Sequence; same for both SEQRES and ATOM records:

>d6nhgd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

Timeline for d6nhgd1:

• d6nhgd1 first appeared in SCOPe 2.07