SCOPe 2.07: Domain d6nnga2: 6nng A:246-439

Lineage for d6nnga2 (6nng A:246-439)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)

Domain d6nnga2: 6nng A:246-439 [370776]
Other proteins in same PDB: d6nnga1, d6nngb1, d6nngc1, d6nngd1, d6nnge_, d6nngf1, d6nngf2, d6nngf3
automated match to d4i50a2
complexed with acp, ca, dj9, gdp, gtp, mes, mg

Details for d6nnga2

PDB Entry: 6nng (more details), 2.4 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound dj95

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6nnga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nnga2 d.79.2.1 (A:246-439) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d6nnga2:

Click to download the PDB-style file with coordinates for d6nnga2.
(The format of our PDB-style files is described here.)

Timeline for d6nnga2: