Lineage for d6nhgh_ (6nhg H:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027753Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 3027754Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 3027755Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 3027756Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 3027771Species Cow (Bos taurus) [TaxId:9913] [81526] (14 PDB entries)
    Uniprot P00126
  8. 3027783Domain d6nhgh_: 6nhg H: [370762]
    Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgb1, d6nhgb2, d6nhgc1, d6nhgc2, d6nhgd1, d6nhgd2, d6nhge1, d6nhge2, d6nhgg_, d6nhgj_, d6nhgk_
    automated match to d1ntmh_
    complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3

Details for d6nhgh_

PDB Entry: 6nhg (more details), 2.8 Å

PDB Description: rhodobacter sphaeroides mitochondrial respiratory chain complex
PDB Compounds: (H:) cytochrome b-c1 complex subunit 6, mitochondrial

SCOPe Domain Sequences for d6nhgh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nhgh_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
klfnslk

SCOPe Domain Coordinates for d6nhgh_:

Click to download the PDB-style file with coordinates for d6nhgh_.
(The format of our PDB-style files is described here.)

Timeline for d6nhgh_: