![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) ![]() automatically mapped to Pfam PF08997 |
![]() | Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins) |
![]() | Protein automated matches [190648] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187726] (5 PDB entries) |
![]() | Domain d6nhgk_: 6nhg K: [370759] Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgb1, d6nhgb2, d6nhgc1, d6nhgc2, d6nhgd1, d6nhgd2, d6nhge1, d6nhge2, d6nhgg_, d6nhgh_, d6nhgj_ automated match to d1sqqk1 complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3 |
PDB Entry: 6nhg (more details), 2.8 Å
SCOPe Domain Sequences for d6nhgk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nhgk_ f.23.15.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfk
Timeline for d6nhgk_: