SCOP 1.65: Domain d1bgo__: 1bgo -

Lineage for d1bgo__ (1bgo -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (9 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (20 proteins)

6. Protein (Pro)cathepsin K [54028] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (14 PDB entries)

8. Domain d1bgo__: 1bgo - [37074]
   complexed with i10

Details for d1bgo__

PDB Entry: 1bgo, 2.3 Å

PDB Description: crystal structure of cysteine protease human cathepsin k in complex with a covalent peptidomimetic inhibitor

SCOP Domain Sequences for d1bgo__:

Sequence; same for both SEQRES and ATOM records:

>d1bgo__ d.3.1.1 (-) (Pro)cathepsin K {Human (Homo sapiens)}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d1bgo__:

• d1bgo__ first appeared (with stable ids) in SCOP 1.55
  
• d1bgo__ appears in SCOP 1.63
  
• d1bgo__ appears in SCOP 1.67
  
• d1bgo__ appears in the current release, SCOPe 2.08, called d1bgoa_