SCOP 1.69: Domain d1ayv__: 1ayv -

Lineage for d1ayv__ (1ayv -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (11 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (23 proteins)

6. Protein (Pro)cathepsin K [54028] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (17 PDB entries)

8. Domain d1ayv__: 1ayv - [37072]

Details for d1ayv__

PDB Entry: 1ayv, 2.3 Å

PDB Description: crystal structure of cysteine protease human cathepsin k in complex with a covalent thiazolhydrazide inhibitor

SCOP Domain Sequences for d1ayv__:

Sequence; same for both SEQRES and ATOM records:

>d1ayv__ d.3.1.1 (-) (Pro)cathepsin K {Human (Homo sapiens)}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d1ayv__:

• d1ayv__ first appeared (with stable ids) in SCOP 1.55
  
• d1ayv__ appears in SCOP 1.67
  
• d1ayv__ appears in SCOP 1.71
  
• d1ayv__ appears in the current release, SCOPe 2.08, called d1ayva_